PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00136206001
Common NameGSBRNA2T00136206001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 268aa    MW: 29845.7 Da    PI: 9.8058
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00136206001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA89.54.6e-28127183258
            CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                           ++YVN+KQy++I++RRq+Rak+  ++k+++  ++py+h+SRh hA+rRpRgsgGrF
  GSBRNA2T00136206001 127 GTIYVNSKQYHGIIRRRQSRAKALLKNKINNFRKQPYMHHSRHLHAMRRPRGSGGRF 183
                          689**************************9**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.2E-30124186IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.007125186IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.3E-23128183IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.6E-20128150IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.6E-20160183IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MQTEYCKERE ELFSPPQASC LWNIAFGPPA LTQESLSSDS FAGVKVVTPE TESEQGGGKS  60
SRDHVSKPHV AFAMQSSCFE FGFAQPTIYK KHPDHVGQYY GVISGYGSQI SPNRVMLPLK  120
METEEDGTIY VNSKQYHGII RRRQSRAKAL LKNKINNFRK QPYMHHSRHL HAMRRPRGSG  180
GRFLNTKKAD AALQSRPSNP QSSEVFHPKN RTMTSSMETY GPNVSSSDVT SMNHFLSPSI  240
YYNGGNMGIP SKWIATAMDI GCCNLKT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-14129191566NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00136206001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7876871e-139KC787687.1 Brassica napus transcription factor subunit NF-YA10.1 (NF-YA10.1) gene, complete cds.
GenBankKC7876881e-139KC787688.1 Brassica napus transcription factor subunit NF-YA10.2 (NF-YA10.2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009122258.10.0PREDICTED: nuclear transcription factor Y subunit A-10 isoform X3
SwissprotQ8LFU01e-117NFYAA_ARATH; Nuclear transcription factor Y subunit A-10
TrEMBLA0A078C5580.0A0A078C558_BRANA; BnaA10g24470D protein
TrEMBLM4CYA30.0M4CYA3_BRARP; Uncharacterized protein
STRINGBra009200.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30082767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.21e-118nuclear factor Y, subunit A10
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]